PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.0617s0003.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family G2-like
Protein Properties Length: 226aa    MW: 24957.6 Da    PI: 4.9453
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.0617s0003.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like93.51.7e-29148202156
              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                          kp+++WtpeLH++Fv+aveqL G +kA+P++ile+m+vk+Lt+++v+SHLQkYR++
  Araha.0617s0003.1.p 148 KPKVDWTPELHRKFVQAVEQL-GVDKAVPSRILEIMNVKSLTRHNVASHLQKYRSH 202
                          79*******************.********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.18145204IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.9E-29146205IPR009057Homeodomain-like
SuperFamilySSF466892.51E-20146205IPR009057Homeodomain-like
TIGRFAMsTIGR015576.5E-27148202IPR006447Myb domain, plants
PfamPF002491.1E-8151200IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009658Biological Processchloroplast organization
GO:0009910Biological Processnegative regulation of flower development
GO:0010380Biological Processregulation of chlorophyll biosynthetic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1900056Biological Processnegative regulation of leaf senescence
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 226 aa     Download sequence    Send to blast
MLTVSPAPLI GNNSKDTYMA SDFVDFTTEG LPDFTTVGDF SDDLLDGIDY YDDLFIGFDG  60
DDVLPDLEID TEILGEYSGS GRDEEQEMEG NTSTASETSE RDGGHGCKQE GGGGGGDGGV  120
RDKTVRRGKR KGKKNKDCLS DDNDIKKKPK VDWTPELHRK FVQAVEQLGV DKAVPSRILE  180
IMNVKSLTRH NVASHLQKYR SHRKHLLARE AEAASWNLRR HATVAV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A6e-20146200357ARR10-B
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1125133RRGKRKGKK
2128136KRKGKKNKD
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0624900.0AB062490.1 Arabidopsis thaliana mRNA for GPRI2, complete cds.
GenBankAY0267730.0AY026773.1 Arabidopsis thaliana golden2-like transcription factor (GLK2) mRNA, complete cds.
GenBankAY0503860.0AY050386.1 Arabidopsis thaliana AT5g44190/MLN1_11 mRNA, complete cds.
GenBankAY1248190.0AY124819.1 Arabidopsis thaliana AT5g44190/MLN1_11 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010441919.11e-141PREDICTED: transcription activator GLK2-like
SwissprotQ9FFH01e-135GLK2_ARATH; Transcription activator GLK2
TrEMBLD7MN201e-126D7MN20_ARALL; Putative uncharacterized protein
STRINGAT5G44190.11e-133(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM22092773
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G44190.11e-109GOLDEN2-like 2